PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P31660_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 859aa    MW: 93687.9 Da    PI: 6.505
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P31660_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-182583357
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           k  ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr4P31660_001 25 KYVRYTPEQVEALERVYSECPKPSSLKRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 83
                           5678*****************************************************97 PP

2START166.12.5e-521743822205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s++ sg a+ra+g+v  +++  v+e+l+d++ W ++++  +++ vi +g 
  GSMUA_Achr4P31660_001 174 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNVSGVAARACGLVSLEPT-KVAEILKDRPSWYRDCRCLDVVTVIPTGn 260
                            68999********************************99999****************.8888888888******************* PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l++++++a+++l++ Rdf+++Ry+  l++g++vi+++S+++ +  p     +++vRae+l Sg+li+p+++g+s +++v+hvd
  GSMUA_Achr4P31660_001 261 gGNIELIYMQTYAPTTLAAaRDFWMLRYTTGLEDGSLVICERSLTPATGGPAgppAPNFVRAEVLSSGYLIRPCEGGGSMIHIVDHVD 348
                            ***********************************************99998889********************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l++++++++lr+l++s  + ++k++ a+l+++++
  GSMUA_Achr4P31660_001 349 LDAWSVPEVLRPLYESPKILAQKMTIAALRHLKQ 382
                            *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-18883IPR009057Homeodomain-like
PROSITE profilePS5007115.4512084IPR001356Homeobox domain
SMARTSM003894.8E-152288IPR001356Homeobox domain
CDDcd000865.19E-162585No hitNo description
SuperFamilySSF466891.24E-162587IPR009057Homeodomain-like
PfamPF000465.2E-162683IPR001356Homeobox domain
CDDcd146861.82E-677116No hitNo description
PROSITE profilePS5084825.804164392IPR002913START domain
CDDcd088751.68E-65168384No hitNo description
Gene3DG3DSA:3.30.530.204.3E-23172378IPR023393START-like domain
SMARTSM002347.8E-48173383IPR002913START domain
SuperFamilySSF559611.92E-38174385No hitNo description
PfamPF018523.1E-50174382IPR002913START domain
PfamPF086701.5E-47710858IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MAMVVSGKET GKSQQAAALA MDSGKYVRYT PEQVEALERV YSECPKPSSL KRQQLIRECP  60
ILSNIEPKQI KVWFQNRRCR EKQRKEASRL QTVNRKLTAM NKLLMEENDR LQKQVSQLVY  120
ENGYMRQQLH NTSVATTDTS CESVVTSGQH HHQQNPTPQH SQRDANNPAG LLAIAEETLA  180
EFLSKATGTA VDWVQMVGMK PGPDSIGIIA VSHNVSGVAA RACGLVSLEP TKVAEILKDR  240
PSWYRDCRCL DVVTVIPTGN GGNIELIYMQ TYAPTTLAAA RDFWMLRYTT GLEDGSLVIC  300
ERSLTPATGG PAGPPAPNFV RAEVLSSGYL IRPCEGGGSM IHIVDHVDLD AWSVPEVLRP  360
LYESPKILAQ KMTIAALRHL KQIAQETSGE VPYGGGRQPA VLRTFSQRLS RGFNDAVNGF  420
ADDGWSLLGS DGVDDVTIAV NSSPNKLLGS HVNTSAMFST LGVGVLCAKA SMLLQNVPPA  480
MLVRFLREHR SEWADCGVDA YSAASMRASP YAVPGVRASS GFLGSQMILP LAHTVEHEEF  540
LEVIRLEGHG FNQDDVILPR DMYLLQLCSG VDENAIGSCA QLVFAPIDES FADDVPLLPS  600
GFRVIPLDPK TDSSTATRTL DLASTLEIGS GATACSVKET ASNAYNLRSV LTIAFQFTCE  660
NHLQGNVAAM ARQYVRSVVA SVQRVAMAIA PRPGCQIGVK HPPGSPEAHT LARWVSRSYR  720
AHTGVDLFRV DSQASDSLLK LLWHHSDSIM CCSLKASDSM EASPVFTFSN QAGLDMLETT  780
LIALQDITLE KILDDGARKV LCSEFPKIMQ QGHAYLPAGI CMSSMGRPVS YEQAVAWKVS  840
NEEDSPHCLA FMFVNWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397391.10.0PREDICTED: homeobox-leucine zipper protein HOX32-like
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0STS80.0M0STS8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P31660_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein